PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm_27.model.AmTr_v1.0_scaffold00094.1
Common NameAMTR_s00094p00028710, LOC18426326
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; basal Magnoliophyta; Amborellales; Amborellaceae; Amborella
Family G2-like
Protein Properties Length: 298aa    MW: 33349.8 Da    PI: 7.7023
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm_27.model.AmTr_v1.0_scaffold00094.1genomeTAGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like106.21.9e-333286155
                                 G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                                            kprlrWt eLH+rFv+av+qLGG++kAtPk+i+++m+vkgLtl+h+kSHLQk+Rl
  evm_27.model.AmTr_v1.0_scaffold00094.1 32 KPRLRWTVELHDRFVDAVTQLGGPDKATPKSIMRVMGVKGLTLYHLKSHLQKFRL 86
                                            79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.9E-322987IPR009057Homeodomain-like
PROSITE profilePS5129412.082989IPR017930Myb domain
SuperFamilySSF466899.85E-173187IPR009057Homeodomain-like
TIGRFAMsTIGR015573.4E-243287IPR006447Myb domain, plants
PfamPF002491.0E-73484IPR001005SANT/Myb domain
PfamPF143792.7E-23129175IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010088Biological Processphloem development
GO:0010089Biological Processxylem development
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 298 aa     Download sequence    Send to blast
MFHPKKPPNM CSQERQMCVQ GDSGLVLTTD PKPRLRWTVE LHDRFVDAVT QLGGPDKATP  60
KSIMRVMGVK GLTLYHLKSH LQKFRLGKQP HKEFNDHSSK ESERAAVLEL QRSGASSSGI  120
MGRDGNDNMQ VREAVRMQME VQRRFTEQLE VQKHLQLRIE AQGKYMQNIL EKAFQTIAGE  180
TMTSGSLKAG GSSHQGLLDL GASCMNYPCL QDLHIYGGDQ NPHHHQLELQ SGGQIDSAFM  240
SSQEDTQEEF DGAFETKPLQ VMEGDCSINK KFEMRAPSNH MSMPRPITPS ARNHSYG*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006833019.10.0PREDICTED: myb family transcription factor APL
SwissprotQ9SAK59e-96APL_ARATH; Myb family transcription factor APL
TrEMBLW1NR550.0W1NR55_AMBTC; Uncharacterized protein
STRINGVIT_19s0085g00890.t011e-105(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP7817262
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G79430.25e-97G2-like family protein
Publications ? help Back to Top
  1. Amborella Genome Project
    The Amborella genome and the evolution of flowering plants.
    Science, 2013. 342(6165): p. 1241089
    [PMID:24357323]